PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA87G00132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 466aa    MW: 53806.9 Da    PI: 4.4699
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA87G00132genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-15130176148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed +l  +v+++G + W+ Ia+++  gR +kqc++rw+++l
       AA87G00132 130 KGQWTIQEDRQLRALVREYGEKKWTDIANMFE-GRIGKQCRERWHNHL 176
                      799*****************************.*************97 PP

2Myb_DNA-binding568.9e-18183224245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT+eEd++l++a+ +lG++ W+ Ia +++ gRt++ +k++w+
       AA87G00132 183 SVWTEEEDQILIEAHMELGNR-WAEIAYRLP-GRTENTIKNHWN 224
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.419125180IPR017930Myb domain
SuperFamilySSF466895.74E-30127223IPR009057Homeodomain-like
SMARTSM007174.3E-14129178IPR001005SANT/Myb domain
PfamPF002491.9E-14130176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-24131182IPR009057Homeodomain-like
CDDcd001675.20E-13133176No hitNo description
SMARTSM007172.7E-17181229IPR001005SANT/Myb domain
PROSITE profilePS5129419.25181231IPR017930Myb domain
PfamPF002491.9E-16183224IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-21183229IPR009057Homeodomain-like
CDDcd001673.44E-13185227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MNQDPNAIQF HQFFNDDQSY KPVFEANFDH YSQDLVSQIP INDYNHLIWD INPRWDGIEY  60
NNQDFITNGH KPILDQINFQ PSDLLLQENC DFTTPILGEN LSKIDVTEKN KNKLVKVIQN  120
KSFKKTNFIK GQWTIQEDRQ LRALVREYGE KKWTDIANMF EGRIGKQCRE RWHNHLRPEI  180
KKSVWTEEED QILIEAHMEL GNRWAEIAYR LPGRTENTIK NHWNATKRRF FSKNYKKLYA  240
NGGSLMNYIK SIMSNNNNIM DQNSFQFPPN HYSNLDLNLD ANLDSNLYST LDLNLDANLD  300
YSTLNSNLDS NLYSTFDPNL VSNLDLNLDS NLVPNVNSNL VPNFVPNLDA NLDANFDLNL  360
DLNLDANLDL NLEILGNDNG VKSLELGENE CKYVNDGMMN LNVGNERFEG NNHDSAAAAA  420
MTTPSVYVPV FSATFGSDDL VYDHELMMKT LDEMKDDVEF CKILQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-461282292103C-Myb DNA-Binding Domain
1msf_C8e-461282292103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087679.11e-59Transcription factor
TrEMBLW9QL281e-59W9QL28_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133031427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-53myb domain protein 118